| Edit |   |
| Antigenic Specificity | Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PTGER3 is the receptor for prostaglandin E2 (PGE2), the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems. |
| Immunogen | PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL |
| Other Names | PTGER3|EP3|EP3-I|EP3-II|EP3-III|EP3-IV|EP3e|PGE2-R|PTGEREP3|Rep3|rEP3a|rEP3b|Pgerep3|Ptgerep3 |
| Gene, Accession # | Gene ID: 5733 |
| Catalog # | ABIN635100 |
| Price | |
| Order / More Info | Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |