| Edit |   |
|---|
| Antigenic Specificity | Disrupted in Schizophrenia 1 (DISC1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DOT1L is a histone methyltransferase. It methylates 'Lys-79' of histone H3. Nucleosomes are preferred as substrate compared to free histones. |
|---|
| Immunogen | DISC1 antibody was raised using the middle region of DISC1 corresponding to a region with amino acids LAGRKPAPAGEPVNSSKWKSTFSPISDIGLAKSADSPLQASSALSQNSLF |
|---|
| Other Names | DISC1|C1orf136|SCZD9 |
|---|
| Gene, Accession # | Gene ID: 27185 |
|---|
| Catalog # | ABIN630572 |
|---|
| Price | |
|---|
| Order / More Info | Disrupted in Schizophrenia 1 (DISC1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|