| Edit |   |
| Antigenic Specificity | Disrupted in Schizophrenia 1 (DISC1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DISC1 is a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. |
| Immunogen | DISC1 antibody was raised using the N terminal of DISC1 corresponding to a region with amino acids AACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSE |
| Other Names | DISC1|C1orf136|SCZD9 |
| Gene, Accession # | Gene ID: 27185 |
| Catalog # | ABIN630972 |
| Price | |
| Order / More Info | Disrupted in Schizophrenia 1 (DISC1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |