| Edit |   |
|---|
| Antigenic Specificity | Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TRAM1L1 is stimulatory or required for the translocation of secretory proteins across the ER membrane. |
|---|
| Immunogen | TRAM1 L1 antibody was raised using the middle region of TRAM1 1 corresponding to a region with amino acids LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL |
|---|
| Other Names | A830091N21Rik |
|---|
| Gene, Accession # | Gene ID: 133022 |
|---|
| Catalog # | ABIN635623 |
|---|
| Price | |
|---|
| Order / More Info | Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|