| Edit |   |
|---|
| Antigenic Specificity | C1orf159/RIVIG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C1orf159/RIVIG Antibody from Novus Biologicals is a rabbit polyclonal antibody to C1orf159/RIVIG. This antibody reacts with human. The C1orf159/RIVIG Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human C1orf159. Peptide sequence PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPV. |
|---|
| Other Names | chromosome 1 open reading frame 159, RP11-465B22.4 |
|---|
| Gene, Accession # | C1ORF159, Gene ID: 54991, Accession: CAI14318, SwissProt: CAI14318 |
|---|
| Catalog # | NBP1-91308-20ul |
|---|
| Price | |
|---|
| Order / More Info | C1orf159/RIVIG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|