| 产品详情 |
| Edit |   |
| Antigenic Specificity | ARFGAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARFGAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARFGAP1. This antibody reacts with human. The ARFGAP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ARFGAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRSSDSWEV WGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWD |
| Other Names | ADP-ribosylation factor 1 GTPase activating protein, ADP-ribosylation factor 1 GTPase-activating protein, ADP-ribosylation factor GTPase activating protein 1, ADP-ribosylation factor GTPase-activating protein 1, ARF GAP 1, ARF1 GAP, ARF1-directed GTPase-activating protein, ARF1GAP, bA261N11.3, FLJ10767, GAP protein, HRIHFB2281, MGC39924 |
| Gene, Accession # | ARFGAP1, Gene ID: 55738 |
| Catalog # | NBP2-14305 |
| Price | |
| Order / More Info | ARFGAP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|