| Edit |   |
|---|
| Antigenic Specificity | Lymphocyte Expansion Molecule |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lymphocyte Expansion Molecule Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lymphocyte Expansion Molecule. This antibody reacts with human. The Lymphocyte Expansion Molecule Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C1ORF177 The peptide sequence was selected from the middle region of C1ORF177. Peptide sequence YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN. |
|---|
| Other Names | chromosome 1 open reading frame 177 |
|---|
| Gene, Accession # | C1ORF177, Gene ID: 163747 |
|---|
| Catalog # | NBP1-70454 |
|---|
| Price | |
|---|
| Order / More Info | Lymphocyte Expansion Molecule Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|