| Edit |   |
| Antigenic Specificity | PLEKHA9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PLEKHA9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLEKHA9. This antibody reacts with human. The PLEKHA9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PLEKHA9(pleckstrin homology domain containing, family A member 9) The peptide sequence was selected from the N terminal of PLEKHA9. Peptide sequence VGTLLKSTCNTFLKTLEECMQIANAAFTSELLYHTPPGSPQLAMLKSSKM. |
| Other Names | PLEKHA8P1 pleckstrin homology domain containing, family A member 8 pseudogene 1 |
| Gene, Accession # | PLEKHA9, Gene ID: 51054 |
| Catalog # | NBP1-70676-20ul |
| Price | |
| Order / More Info | PLEKHA9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |