| 产品详情 |
| Edit |   |
| Antigenic Specificity | PLEKHF2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PLEKHF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLEKHF2. This antibody reacts with human. The PLEKHF2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PLEKHF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSN |
| Other Names | FLJ13187, PH and FYVE domain-containing protein 2, Phafin-2, PHAFIN2, pleckstrin homology domain containing, family F (with FYVE domain) member 2, pleckstrin homology domain-containing family F member 2, ZFYVE18PH domain-containing family F member 2, Zinc finger FYVE domain-containing protein 18 |
| Gene, Accession # | PLEKHF2, Gene ID: 79666 |
| Catalog # | NBP1-82265 |
| Price | |
| Order / More Info | PLEKHF2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23435261 |
| 产品资料 |
|
|