| Edit |   |
|---|
| Antigenic Specificity | S100P binding protein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100P binding protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to S100P binding protein. This antibody reacts with human. The S100P binding protein Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to S100PBP(S100P binding protein) The peptide sequence was selected from the middle region of S100PBP. Peptide sequence ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ. |
|---|
| Other Names | DKFZp313K2325, FLJ12903, S100P binding protein, S100P-binding protein, S100P-binding protein Riken, S100PBPRS100P binding protein 1 |
|---|
| Gene, Accession # | S100PBP, Gene ID: 64766, Accession: A8MTZ6, SwissProt: A8MTZ6 |
|---|
| Catalog # | NBP1-56954-20ul |
|---|
| Price | |
|---|
| Order / More Info | S100P binding protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|