| Edit |   |
|---|
| Antigenic Specificity | S100P Binding Protein (S100PBP) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of S100PBP protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | S100 PBP antibody was raised using the middle region of S100 BP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ |
|---|
| Other Names | s100pbpr|S100PBPR|4930429A08Rik|AI851343|S100pbpr|RGD1564943 |
|---|
| Gene, Accession # | Gene ID: 64766 |
|---|
| Catalog # | ABIN633020 |
|---|
| Price | |
|---|
| Order / More Info | S100P Binding Protein (S100PBP) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|