| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tryptophan hydroxylase 2 |
|---|
| Clone | 2990 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tryptophan hydroxylase 2 Antibody (2990) from Novus Biologicals is a mouse monoclonal antibody to Tryptophan hydroxylase 2. This antibody reacts with human, mouse, rat. The Tryptophan hydroxylase 2 Antibody (2990) has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Tryptophan hydroxylase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG |
|---|
| Other Names | ADHD7, EC 1.14.16, EC 1.14.16.4, FLJ37295, MGC138872, Neuronal tryptophan hydroxylase, NTPHMGC138871, tryptophan 5-hydroxylase 2, Tryptophan 5-monooxygenase 2, tryptophan hydroxylase 2 |
|---|
| Gene, Accession # | TPH2, Gene ID: 121278, Accession: Q8IWU9 |
|---|
| Catalog # | NBP2-46646 |
|---|
| Price | |
|---|
| Order / More Info | Tryptophan hydroxylase 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|