| Edit |   |
| Antigenic Specificity | GDF11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human GDF11 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DFQGDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMF |
| Other Names | growth differentiation factor 11, BMP-11 |
| Gene, Accession # | Gene ID: 10220, UniProt: O95390, ENSG00000135414 |
| Catalog # | HPA060985 |
| Price | |
| Order / More Info | GDF11 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |