| Edit |   |
| Antigenic Specificity | SSC5D |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SSC5D Antibody from Novus Biologicals is a rabbit polyclonal antibody to SSC5D. This antibody reacts with human. The SSC5D Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SSC5D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TCTGYTDYDDYPPWTWDPTSREDLAKGTTTAGVPGHTLPWRTTRRPGSSSPAIRRLPDTGSKDGYKLPWTWDTPSGRGLAEGTPTAGKLGPTL |
| Other Names | scavenger receptor cysteine rich domain containing (5 domains), scavenger receptor cysteine-rich glycoprotein, soluble scavenger protein with 5 SRCR domains, soluble scavenger receptor cysteine-rich domain-containing protein SSC5D, soluble scavenger with 5 domains |
| Gene, Accession # | SSC5D, Gene ID: 284297 |
| Catalog # | NBP1-93831 |
| Price | |
| Order / More Info | SSC5D Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |