| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ILT4/CD85d/LILRB2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ILT4/CD85d/LILRB2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ILT4/CD85d/LILRB2. This antibody reacts with human. The ILT4/CD85d/LILRB2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is LILRB2 - C-terminal region. Peptide sequence MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA. |
|---|
| Other Names | CD85 antigen-like family member D, CD85d antigen, Ig-like transcript 4, ILT-4, ILT4CD85d, Immunoglobulin-like transcript 4, Leukocyte immunoglobulin-like receptor 2, leukocyte immunoglobulin-like receptor subfamily B member 2, leukocyte immunoglobulin-like receptor subfamily B member 2 soluble isoform, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LIR2CD85D, LIR-2subfamily A (with TM domain), member 6, member 2, MIR10LILRA6, Monocyte/macrophage immunoglobulin-like receptor 10 |
|---|
| Gene, Accession # | LILRB2, Gene ID: 10288, Accession: NP_005865, SwissProt: NP_005865 |
|---|
| Catalog # | NBP1-98554-20ul |
|---|
| Price | |
|---|
| Order / More Info | ILT4/CD85d/LILRB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|