| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ILT6/CD85e/LILRA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ILT6/CD85e/LILRA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ILT6/CD85e/LILRA3. This antibody reacts with human. The ILT6/CD85e/LILRA3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is LILRA3 - C-terminal region. Peptide sequence AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP. |
|---|
| Other Names | CD85 antigen-like family member E, CD85e antigen, HM31, ILT-6, ILT6CD85e, Immunoglobulin-like transcript 6, leucocyte immunoglobulin-like receptor, Leukocyte immunoglobulin-like receptor 4, leukocyte immunoglobulin-like receptor A3, leukocyte immunoglobulin-like receptor subfamily A member 3, leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member3, LIR4CD85E, LIR-4HM43e3, Monocyte inhibitory receptor HM43/HM31 |
|---|
| Gene, Accession # | LILRA3, Gene ID: 11026, Accession: NP_006856, SwissProt: NP_006856 |
|---|
| Catalog # | NBP1-98549-20ul |
|---|
| Price | |
|---|
| Order / More Info | ILT6/CD85e/LILRA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|