| 产品详情 |
| Edit |   |
| Antigenic Specificity | ILT7/CD85g/LILRA4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ILT7/CD85g/LILRA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ILT7/CD85g/LILRA4. This antibody reacts with human. The ILT7/CD85g/LILRA4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ILT7/CD85g/LILRA4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD |
| Other Names | CD85 antigen-like family member G, CD85g, CD85g antigen, ILT-7, ILT7MGC129598, Immunoglobulin-like transcript 7, leukocyte immunoglobulin-like receptor subfamily A member 4, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4, leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member4, MGC129597 |
| Gene, Accession # | LILRA4, Gene ID: 23547 |
| Catalog # | NBP2-48932 |
| Price | |
| Order / More Info | ILT7/CD85g/LILRA4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|