| Edit |   |
| Antigenic Specificity | VMAT1/SLC18A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VMAT1/SLC18A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VMAT1/SLC18A1. This antibody reacts with human. The VMAT1/SLC18A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VMAT1/SLC18A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEI |
| Other Names | solute carrier family 18 (vesicular monoamine), member 1 |
| Gene, Accession # | SLC18A1, Gene ID: 6570 |
| Catalog # | NBP2-58895 |
| Price | |
| Order / More Info | VMAT1/SLC18A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |