| Edit |   |
|---|
| Antigenic Specificity | CD40 Ligand (CD40LG) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. |
|---|
| Immunogen | CD40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
|---|
| Other Names | CD154|cd40l|CD40L|HIGM1|IGM|IMD3|T-BAM|TNFSF5|TRAP|gp39|hCD40L|CD40-L|Cd40l|Ly-62|Ly62|Tnfsf5 |
|---|
| Gene, Accession # | Gene ID: 959 |
|---|
| Catalog # | ABIN634665 |
|---|
| Price | |
|---|
| Order / More Info | CD40 Ligand (CD40LG) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|