| Edit |   |
|---|
| Antigenic Specificity | MTCH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MTCH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MTCH2. This antibody reacts with human. The MTCH2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MTCH2(mitochondrial carrier homolog 2 (C. elegans)) The peptide sequence was selected from the N terminal of MTCH2. Peptide sequence ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL. |
|---|
| Other Names | 2310034D24Rik, Met-induced mitochondrial protein, MIMP, mitochondrial carrier 2, mitochondrial carrier homolog 2, mitochondrial carrier homolog 2 (C. elegans) |
|---|
| Gene, Accession # | MTCH2, Gene ID: 23788, Accession: Q9Y6C9, SwissProt: Q9Y6C9 |
|---|
| Catalog # | NBP1-54790-20ul |
|---|
| Price | |
|---|
| Order / More Info | MTCH2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|