| Edit |   |
| Antigenic Specificity | MTCH2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MTCH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MTCH2. This antibody reacts with human. The MTCH2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MTCH2(mitochondrial carrier homolog 2 (C. elegans)) The peptide sequence was selected from the N terminal of MTCH2. Peptide sequence ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL. |
| Other Names | 2310034D24Rik, Met-induced mitochondrial protein, MIMP, mitochondrial carrier 2, mitochondrial carrier homolog 2, mitochondrial carrier homolog 2 (C. elegans) |
| Gene, Accession # | MTCH2, Gene ID: 23788, Accession: Q9Y6C9, SwissProt: Q9Y6C9 |
| Catalog # | NBP1-54790 |
| Price | |
| Order / More Info | MTCH2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |