| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLBD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLBD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLBD1. This antibody reacts with human. The PLBD1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PLBD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WMPAEKTVQVKNVMDKNGDAYGFYNNSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTNLYPQLITKPSIMDKVQDFMEKQD |
|---|
| Other Names | EC 3.1.1, EC 3.1.1.-, FLJ22662, LAMA-like protein 1, Lamina ancestor homolog 1, phospholipase B domain containing 1, Phospholipase B domain-containing protein 1, PLB homolog 1, putative phospholipase B-like 1 |
|---|
| Gene, Accession # | PLBD1, Gene ID: 79887, Accession: Q6P4A8, SwissProt: Q6P4A8 |
|---|
| Catalog # | NBP2-37893 |
|---|
| Price | |
|---|
| Order / More Info | PLBD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|