| Edit |   |
|---|
| Antigenic Specificity | IGFLR1/TMEM149 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IGFLR1/TMEM149 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IGFLR1/TMEM149. This antibody reacts with human. The IGFLR1/TMEM149 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM149(transmembrane protein 149) The peptide sequence was selected from the N terminal of TMEM149. Peptide sequence WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP. |
|---|
| Other Names | FLJ22573, transmembrane protein 149, U2 small nuclear RNA auxiliary factor 1-like 4, U2(RNU2) small nuclear RNA auxiliary factor 1-like 4, U2AF1L4 |
|---|
| Gene, Accession # | IGFLR1, Gene ID: 79713, Accession: Q9H665, SwissProt: Q9H665 |
|---|
| Catalog # | NBP1-69417 |
|---|
| Price | |
|---|
| Order / More Info | IGFLR1/TMEM149 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|