| Edit |   |
|---|
| Antigenic Specificity | GLIPR1L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, yeast, rabbit, dog, rat, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-GLIPR1L2 Antibody |
|---|
| Immunogen | The immunogen for Anti-GLIPR1L2 antibody is: synthetic peptide directed towards the C-terminal region of Human GLIPR1L2. Synthetic peptide located within the following region: IFTPEESEAGNEEEEKEEEKKEKEEMEMEIMEMEEEKEEREEEEEETQKE |
|---|
| Other Names | GLI pathogenesis-related 1 like 2 |
|---|
| Gene, Accession # | GRPL2, Accession: NM_152436 |
|---|
| Catalog # | TA330807 |
|---|
| Price | |
|---|
| Order / More Info | GLIPR1L2 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|