| Edit |   |
|---|
| Antigenic Specificity | Glis1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal anti-Glis1 antibody |
|---|
| Immunogen | The immunogen for anti-Glis1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DKRPKEAPGAPGQGRGPVSLGAHMAFRIAVSGGGCGDGNPLDLLPRLPVP |
|---|
| Other Names | GLIS family zinc finger 1 |
|---|
| Gene, Accession # | Glis1, Accession: NM_147221 |
|---|
| Catalog # | TA329588 |
|---|
| Price | |
|---|
| Order / More Info | Glis1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|