| Edit |   |
| Antigenic Specificity | C3orf49 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat, dog, bovine, horse, rabbit |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-C3orf49 Antibody |
| Immunogen | The immunogen for anti-C3orf49 antibody: synthetic peptide directed towards the middle region of human C3orf49. Synthetic peptide located within the following region: IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH |
| Other Names | chromosome 3 open reading frame 49 |
| Gene, Accession # | C3orf49, Accession: NM_138808 |
| Catalog # | TA337642 |
| Price | |
| Order / More Info | C3orf49 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |