| Edit |   |
| Antigenic Specificity | MGC48628 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal Anti-MGC48628 Antibody |
| Immunogen | The immunogen for anti-MGC48628 antibody: synthetic peptide directed towards the N terminal of human MGC48628. Synthetic peptide located within the following region: HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS |
| Other Names | FAM190A, coiled-coil serine-rich protein 1 |
| Gene, Accession # | CCSER1, Accession: NM_207491 |
| Catalog # | TA335111 |
| Price | |
| Order / More Info | MGC48628 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |