| Edit |   |
| Antigenic Specificity | MGC50273 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal Anti-MGC50273 Antibody |
| Immunogen | The immunogen for anti-MGC50273 antibody: synthetic peptide directed towards the N terminal of human MGC50273. Synthetic peptide located within the following region: MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE |
| Other Names | chromosome 2 open reading frame 27B |
| Gene, Accession # | C2orf27B, Accession: NM_214461 |
| Catalog # | TA335120 |
| Price | |
| Order / More Info | MGC50273 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |