| Edit |   |
| Antigenic Specificity | Ecsit |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-Ecsit Antibody |
| Immunogen | The immunogen for anti-Ecsit antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN |
| Other Names | SITPEC, ECSIT signalling integrator |
| Gene, Accession # | Ecsit, Accession: NM_012029 |
| Catalog # | TA342302 |
| Price | |
| Order / More Info | Ecsit Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |