| Edit |   |
|---|
| Antigenic Specificity | SLC35C1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-SLC35C1 Antibody |
|---|
| Immunogen | The immunogen for Anti-SLC35C1 Antibody: synthetic peptide directed towards the N terminal of human SLC35C1. Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG |
|---|
| Other Names | CDG2C, FUCT1, solute carrier family 35 (GDP-fucose transporter), member C1 |
|---|
| Gene, Accession # | FUCT1, Accession: NM_018389 |
|---|
| Catalog # | TA333752 |
|---|
| Price | |
|---|
| Order / More Info | SLC35C1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|