| Edit |   |
| Antigenic Specificity | CNTNAP3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-CNTNAP3 Antibody |
| Immunogen | The immunogen for anti-CNTNAP3 antibody: synthetic peptide directed towards the middle region of human CNTNAP3. Synthetic peptide located within the following region: GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA |
| Other Names | CASPR3, CNTNAP3A, contactin associated protein-like 3 |
| Gene, Accession # | CNTP3, Accession: NM_033655 |
| Catalog # | TA342063 |
| Price | |
| Order / More Info | CNTNAP3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |