| Edit |   |
|---|
| Antigenic Specificity | Poly(A) Binding Protein Interacting Protein 1 (PAIP1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. |
|---|
| Immunogen | PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS |
|---|
| Other Names | fb53g01|zgc:91954|wu:fb53g01 |
|---|
| Gene, Accession # | Gene ID: 10605,218693 |
|---|
| Catalog # | ABIN633480 |
|---|
| Price | |
|---|
| Order / More Info | Poly(A) Binding Protein Interacting Protein 1 (PAIP1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|