| Edit |   |
| Antigenic Specificity | ETV3L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ETV3L Antibody from Novus Biologicals is a rabbit polyclonal antibody to ETV3L. This antibody reacts with human. The ETV3L Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human ETV3LThe immunogen for this antibody is ETV3L. Peptide sequence TGQQTPRGPPETSGDKKGSSSSVYRLGSAPGPCRLGLCCHLGSVQGELPG. |
| Other Names | ets variant 3-like, ets variant gene 3-like |
| Gene, Accession # | ETV3L, Gene ID: 440695, Accession: NP_001004341, SwissProt: NP_001004341 |
| Catalog # | NBP1-79213 |
| Price | |
| Order / More Info | ETV3L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |