| Edit |   |
|---|
| Antigenic Specificity | Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PARP11 gene is part of the poly (ADP-ribose) polymerase family. |
|---|
| Immunogen | PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM |
|---|
| Other Names | fd14a11|wu:fd14a11|zgc:165536|parp11|MGC82612|PARP11|ARTD11|C12orf6|5330431N24Rik|AI851877|HIN1L|RGD1561791 |
|---|
| Gene, Accession # | Gene ID: 57097 |
|---|
| Catalog # | ABIN633008 |
|---|
| Price | |
|---|
| Order / More Info | Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|