| 产品详情 |
| Edit |   |
| Antigenic Specificity | Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PARP1 encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. PARP1 can be cleaved resulting in fragements of 29 and 85 kDa. |
| Immunogen | PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD |
| Other Names | fd14a11|wu:fd14a11|zgc:165536|parp11|MGC82612|PARP11|ARTD11|C12orf6|5330431N24Rik|AI851877|HIN1L|RGD1561791 |
| Gene, Accession # | Gene ID: 57097,101187,500323 |
| Catalog # | ABIN630676 |
| Price | |
| Order / More Info | Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 产品资料 |
|
|