| Edit |   |
| Antigenic Specificity | Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PARP3 belongs to the PARP family. These enzymes modify nuclear proteins by poly-ADP-ribosylation, which is required for DNA repair, regulation of apoptosis, and maintenance of genomic stability. PARP3 is preferentially localized to the daughter centriole throughout the cell cycle. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Immunogen | PARP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP |
| Other Names | ADPRT-3|PARP-3|PM38|Adprtl3|fj17c06|wu:fj17c06|zgc:66157|PARP3|parp3|ADPRT3|ADPRTL2|ADPRTL3|ARTD3|IRT1|PADPRT-3|A930002C11Rik|AW990611|Adprt3|pADPRT-3 |
| Gene, Accession # | Gene ID: 10039 |
| Catalog # | ABIN630693 |
| Price | |
| Order / More Info | Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |