| Edit |   |
|---|
| Antigenic Specificity | Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PARP9 contains 2 Macro domains and 1 PARP catalytic domain. PARP9 is overexpressed at significantly higher levels in fatal high-risk diffuse large B-cell lymphomas (DLB-CL) compared to cured low-risk tumors. Overexpression of PARP9 in B-cell lymphoma transfectants may promote malignant B-cell migration. The function of PARP9 remains unknown. |
|---|
| Immunogen | PARP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI |
|---|
| Other Names | RGD1307534|ARTD9|BAL|BAL1|MGC:7868|AW214463|BC003281|Bagl|Bal|PARP-9 |
|---|
| Gene, Accession # | Gene ID: 83666 |
|---|
| Catalog # | ABIN631447 |
|---|
| Price | |
|---|
| Order / More Info | Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|