| Edit |   |
| Antigenic Specificity | PUS7L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PUS7L Antibody |
| Immunogen | The immunogen for Anti-PUS7L Antibody is: synthetic peptide directed towards the N-terminal region of Human PUS7L. Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK |
| Other Names | pseudouridylate synthase 7 homolog (S. cerevisiae)-like |
| Gene, Accession # | PUS7L, Accession: NM_031292 |
| Catalog # | TA331702 |
| Price | |
| Order / More Info | PUS7L Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |