| Edit |   |
|---|
| Antigenic Specificity | PWWP2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal anti-PWWP2A antibody |
|---|
| Immunogen | The immunogen for anti-PWWP2A antibody: synthetic peptide directed towards the C terminal of human PWWP2A. Synthetic peptide located within the following region: PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR |
|---|
| Other Names | MST101, PWWP domain containing 2A |
|---|
| Gene, Accession # | PWP2A, Accession: NM_052927 |
|---|
| Catalog # | TA329566 |
|---|
| Price | |
|---|
| Order / More Info | PWWP2A Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|