| Edit |   |
|---|
| Antigenic Specificity | Tubb2a - C-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-Tubb2a Antibody - C-terminal region |
|---|
| Immunogen | The immunogen for Anti-Tubb2a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tubb2a. Synthetic peptide located within the following region: RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEE |
|---|
| Other Names | CDCBM5, TUBB, TUBB2, dJ40E16.7, tubulin, beta 2A class IIa |
|---|
| Gene, Accession # | TBB2A, Accession: NM_001069 |
|---|
| Catalog # | TA344291 |
|---|
| Price | |
|---|
| Order / More Info | Tubb2a - C-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|