| Edit |   |
|---|
| Antigenic Specificity | Dapl1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, bovine, rat, mouse, dog, porcine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-Dapl1 Antibody |
|---|
| Immunogen | The immunogen for Anti-Dapl1 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dapl1. Synthetic peptide located within the following region: MANEVQVLPSPLKGRYAPAVKAGGMRISKKQEMGVLERHTKKTGLEKTSA |
|---|
| Other Names | death associated protein-like 1 |
|---|
| Gene, Accession # | Dapl1, Accession: NM_029723 |
|---|
| Catalog # | TA331715 |
|---|
| Price | |
|---|
| Order / More Info | Dapl1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|