| Edit |   |
|---|
| Antigenic Specificity | Chromosome 5 Open Reading Frame 33 (C5orf33) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The specific function of C5orf33 is not yet known. |
|---|
| Immunogen | C5 ORF33 antibody was raised using the middle region of C5 rf33 corresponding to a region with amino acids RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA |
|---|
| Other Names | c5orf33|nadkd1|DKFZp468F206|C5orf33|MNADK|NADKD1|1110020G09Rik|4933430B08Rik|Nadkd1|RGD1306809 |
|---|
| Gene, Accession # | Gene ID: 133686 |
|---|
| Catalog # | ABIN632753 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 5 Open Reading Frame 33 (C5orf33) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|