| Edit |   |
|---|
| Antigenic Specificity | Chromosome 7 Open Reading Frame 38 (C7orf38) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of C7ORF38 protein has not been widely studied, and is yet to be fully elucidated. The protein is weakly similar to transposase-like proteins in human and mouse. |
|---|
| Immunogen | C7 ORF38 antibody was raised using the middle region of C7 rf38 corresponding to a region with amino acids QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS |
|---|
| Other Names | C7orf38 |
|---|
| Gene, Accession # | Gene ID: 221786 |
|---|
| Catalog # | ABIN635578 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 7 Open Reading Frame 38 (C7orf38) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|