| Edit |   |
| Antigenic Specificity | Chromosome 8 Open Reading Frame 84 (C8orf84) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown. |
| Immunogen | RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI |
| Other Names | C8orf84|RPESP|C14H8orf84|Gm106|Rpesp|RGD1559717 |
| Gene, Accession # | Gene ID: 157869,226866,297757 |
| Catalog # | ABIN632147 |
| Price | |
| Order / More Info | Chromosome 8 Open Reading Frame 84 (C8orf84) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |