| Edit |   |
|---|
| Antigenic Specificity | Chromosome 9 Open Reading Frame 25 (C9orf25) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus. |
|---|
| Immunogen | C9 ORF25 antibody was raised using the middle region of C9 rf25 corresponding to a region with amino acids SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC |
|---|
| Other Names | C15H9orf25|C9orf25|bA573M23.5|2310028H24Rik |
|---|
| Gene, Accession # | Gene ID: 203259 |
|---|
| Catalog # | ABIN632464 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 9 Open Reading Frame 25 (C9orf25) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|