| Edit |   |
|---|
| Antigenic Specificity | Chromosome 1 Open Reading Frame 111 (C1orf111) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | C1 ORF111 antibody was raised using the N terminal Of C1 rf111 corresponding to a region with amino acids DIAKTAVPTEASSPAQALPPQYQSIIVRQGIQNTALSPDCSLGDTQHGEK |
|---|
| Other Names | RP11-565P22.3|C1orf111 |
|---|
| Gene, Accession # | Gene ID: 284680 |
|---|
| Catalog # | ABIN632227 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 1 Open Reading Frame 111 (C1orf111) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|