| Edit |   |
|---|
| Antigenic Specificity | Chromosome 1 Open Reading Frame 144 (C1orf144) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | C1 orf144 antibody was raised using the N terminal of C1 rf144 corresponding to a region with amino acids MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN |
|---|
| Other Names | MGC82291|MGC76116|DKFZp468H135|C1orf144|SZRD1|1110022I03|D4Ertd22e|C2H1orf144|wu:fb15h05|wu:fk86c07|zgc:109926|RGD1560286 |
|---|
| Gene, Accession # | Gene ID: 26099 |
|---|
| Catalog # | ABIN632581 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 1 Open Reading Frame 144 (C1orf144) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|