| Edit |   |
|---|
| Antigenic Specificity | Chromosome 10 Open Reading Frame 33 (C10ORF33) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C10orf33 is probably involved in oxidoreductase activity. |
|---|
| Immunogen | C10 ORF33 antibody was raised using the N terminal Of C10 rf33 corresponding to a region with amino acids MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAA |
|---|
| Other Names | C10orf33|DKFZp469H0233|FP3420|C26H10orf33|3830409H07Rik|4833409A17Rik|RGD1303232 |
|---|
| Gene, Accession # | Gene ID: 84795 |
|---|
| Catalog # | ABIN631834 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 10 Open Reading Frame 33 (C10ORF33) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|