| Edit |   |
|---|
| Antigenic Specificity | Chromosome 10 Open Reading Frame 54 (C10orf54) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C10ORF54 may be involved in protein binding and receptor activity. |
|---|
| Immunogen | C10 ORF54 antibody was raised using the N terminal Of C10 rf54 corresponding to a region with amino acids TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE |
|---|
| Other Names | MGC112715|MGC151567|B7-H5|B7H5|GI24|PP2135|SISP1|Dies1|VISTA |
|---|
| Gene, Accession # | Gene ID: 64115 |
|---|
| Catalog # | ABIN635024 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 10 Open Reading Frame 54 (C10orf54) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|