| Edit |   |
|---|
| Antigenic Specificity | Chromosome 13 Open Reading Frame 30 (C13orf30) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of Chromosome 13 ORF protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | C13 orf30 antibody was raised using the N terminal of C13 rf30 corresponding to a region with amino acids MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY |
|---|
| Other Names | C12H13orf30|C13orf30|9330158N17|AU021034 |
|---|
| Gene, Accession # | Gene ID: 144809 |
|---|
| Catalog # | ABIN632614 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 13 Open Reading Frame 30 (C13orf30) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|